PDB entry 3rvs

View 3rvs on RCSB PDB site
Description: Structure of the CheYN59D/E89R Tungstate complex
Class: signaling protein
Keywords: two-component, signal transduction, response regulator, cheY, Beta-alpha protein, chemotaxis, CheZ, CheX, CheA, phosphorylation, SIGNALING PROTEIN
Deposited on 2011-05-06, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (3-131)
      • expression tag (2)
      • engineered mutation (61)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d3rvsa1, d3rvsa2
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (3-131)
      • expression tag (2)
      • engineered mutation (61)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d3rvsb1, d3rvsb2
  • Heterogens: MN, WO4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rvsA (A:)
    gshmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisd
    wdmpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatle
    eklnkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rvsA (A:)
    hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
    mpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleek
    lnkifeklgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rvsB (B:)
    gshmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisd
    wdmpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatle
    eklnkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rvsB (B:)
    hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
    mpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleek
    lnkifeklgm