PDB entry 3rvn
View 3rvn on RCSB PDB site
Description: Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89Y
Class: signaling protein
Keywords: Response regulator, two-component, signal transduction, CheY, Beta-alpha protein, Chemotaxis, CheA CheZ CheX, Phosphorylation, SIGNALING PROTEIN
Deposited on
2011-05-06, released
2012-05-09
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-05-09, with a file datestamp of
2012-05-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.188
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:83333]
Gene: b1882, cheY, JW1871
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (3-131)
- expression tag (2)
- engineered mutation (61)
- engineered mutation (91)
Domains in SCOPe 2.02: d3rvna_ - Chain 'B':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:83333]
Gene: b1882, cheY, JW1871
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (3-131)
- expression tag (2)
- engineered mutation (61)
- engineered mutation (91)
- Heterogens: MN, BEF, SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3rvnA (A:)
gshmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisd
wdmpnmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatle
eklnkifeklgm
Sequence, based on observed residues (ATOM records): (download)
>3rvnA (A:)
hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
mpnmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm
- Chain 'B':
No sequence available.