PDB entry 3rvm

View 3rvm on RCSB PDB site
Description: Structure of the CheY-Mn2+ Complex with substitutions at 59 and 89: N59D and E89R
Class: signaling protein
Keywords: Response regulator, two-component, signal transduction, CheY, Beta-alpha protein, Chemotaxis, CheA CheX CheZ, Phosphorylation, SIGNALING PROTEIN
Deposited on 2011-05-06, released 2012-05-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.141
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (3-131)
      • engineered mutation (61)
      • engineered mutation (91)
    Domains in SCOPe 2.05: d3rvma_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3rvmA (A:)
gshmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisd
wdmpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatle
eklnkifeklgm

    Sequence, based on observed residues (ATOM records): (download) 
    >3rvmA (A:)
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm