PDB entry 3rvl

View 3rvl on RCSB PDB site
Description: Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89R
Class: signaling protein
Keywords: Response regulator, two-component, signal transduction, CheY, Beta-alpha protein, Chemotaxis, CheA CheX CheZ, Phosphorylation, SIGNALING PROTEIN
Deposited on 2011-05-06, released 2012-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.157
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (Start-131)
      • engineered mutation (61)
      • engineered mutation (91)
    Domains in SCOPe 2.06: d3rvla_
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (Start-131)
      • engineered mutation (61)
      • engineered mutation (91)
    Domains in SCOPe 2.06: d3rvlb_
  • Heterogens: BEF, MN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rvlA (A:)
    gshmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisd
    wdmpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatle
    eklnkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rvlA (A:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdmp
    nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rvlB (B:)
    gshmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisd
    wdmpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatle
    eklnkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rvlB (B:)
    dkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdmpn
    mdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleeklnk
    ifeklgm