PDB entry 3rsm

View 3rsm on RCSB PDB site
Description: Crystal structure of S108C mutant of PMM/PGM
Class: isomerase
Keywords: isomerase, phosphohexomutase
Deposited on 2011-05-02, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase/phosphoglucomutase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: algC, PA5322
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d3rsma1, d3rsma2, d3rsma3, d3rsma4
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rsmA (A:)
    mstvkaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgchnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rsmA (A:)
    sifraltaetaywigraigseslargepcvavgrdgrlsgpelvkqliqglvdcgcqvsd
    vgmvptpvlyyaanvlegksgvmltgcngfkivvagetlaneqiqalreriekndlasgv
    gsveqvdilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevd
    gnfpnhhpdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtiiypdrllmlf
    akdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmketgallagems
    ghvffkerwfgfddgiysaarlleilsqdqrdsehvfsafpsdistpeinitvtedskfa
    iiealqrdaqwgegnittldgvrvdypkgwglvrasnttpvlvlrfeadteeeleriktv
    frnqlkavdsslpvpf