PDB entry 3rsj

View 3rsj on RCSB PDB site
Description: Structure of HCRF in complex with Ganglioside GD1a
Class: toxin
Keywords: clostridium botulinum type F, ganglioside binding site, GD1a, TOXIN
Deposited on 2011-05-02, released 2011-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BoNT/F
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/f, Botulinum Neurotoxin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rsja1, d3rsja2
  • Chain 'B':
    Compound: BoNT/F
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/f, Botulinum Neurotoxin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rsjb1, d3rsjb2
  • Chain 'C':
    Compound: BoNT/F
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/f, Botulinum Neurotoxin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rsjc1, d3rsjc2
  • Chain 'D':
    Compound: BoNT/F
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/f, Botulinum Neurotoxin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rsjd1, d3rsjd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rsjA (A:)
    ikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndi
    iyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdta
    gnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsd
    nilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryy
    llnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirkngstdisntdnf
    vrkndlayinvvdrdveyrlyadisiakpekiiklirtsnsnnslgqiivmdsignnctm
    nfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rsjA (A:)
    ikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndi
    iyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdta
    gnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsd
    nilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryy
    llnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirkngntdnfvrknd
    layinvvdrdveyrlyadisiakpekiiklirtsnnslgqiivmdsignnctmnfqnnng
    gnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rsjB (B:)
    ikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndi
    iyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdta
    gnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsd
    nilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryy
    llnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirkngstdisntdnf
    vrkndlayinvvdrdveyrlyadisiakpekiiklirtsnsnnslgqiivmdsignnctm
    nfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rsjB (B:)
    dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy
    ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn
    nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni
    lfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryyll
    nllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirknntdnfvrkndlay
    invvdrdveyrlyadisiakpekiiklirtnnslgqiivmdsignnctmnfqnnnggnig
    llgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rsjC (C:)
    ikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndi
    iyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdta
    gnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsd
    nilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryy
    llnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirkngstdisntdnf
    vrkndlayinvvdrdveyrlyadisiakpekiiklirtsnsnnslgqiivmdsignnctm
    nfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rsjC (C:)
    dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy
    ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn
    nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni
    lfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryyll
    nllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirknntdnfvrkndlay
    invvdrdveyrlyadisiakpekiiklirtnnslgqiivmdsignnctmnfqnnnggnig
    llgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rsjD (D:)
    ikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndi
    iyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdta
    gnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsd
    nilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryy
    llnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirkngstdisntdnf
    vrkndlayinvvdrdveyrlyadisiakpekiiklirtsnsnnslgqiivmdsignnctm
    nfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rsjD (D:)
    ikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndi
    iyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdta
    gnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsd
    nilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryy
    llnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirknntdnfvrkndl
    ayinvvdrdveyrlyadisiakpekiiklirtnnslgqiivmdsignnctmnfqnnnggn
    igllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen