PDB entry 3rs1

View 3rs1 on RCSB PDB site
Description: Mouse C-type lectin-related protein Clrg
Class: immune system
Keywords: C-type lectin-like, ligand of NK receptor, natural killer cell receptors, Surface of activated T lymphocytes, IMMUNE SYSTEM
Deposited on 2011-05-02, released 2012-05-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 2 member I
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Clec2i, Clrg, Dcl1, Ocilrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVF9 (0-121)
      • engineered mutation (0)
      • engineered mutation (63)
  • Chain 'B':
    Compound: C-type lectin domain family 2 member I
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Clec2i, Clrg, Dcl1, Ocilrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVF9 (0-121)
      • engineered mutation (0)
      • engineered mutation (63)
    Domains in SCOPe 2.02: d3rs1b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rs1B (B:)
    mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
    dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
    ln