PDB entry 3rrq

View 3rrq on RCSB PDB site
Description: Crystal structure of the extracellular domain of human PD-1
Class: immune system
Keywords: PD-1; Programmed death-1, costimulatory, IMMUNE SYSTEM
Deposited on 2011-04-29, released 2012-05-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PD-1, PD1, PDCD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15116
      • engineered mutation (100)
    Domains in SCOPe 2.02: d3rrqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rrqA (A:)
    wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq
    dcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapklqikeslraelrvterraev
    ptahpspsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rrqA (A:)
    npptfspallvvtegdnatftcsfsntssfvlnwyrmspsnqtdklaafpecrfrvtqlp
    ngrdfhmsvvrarrndsgtylcgaislapklqikeslraelrvterra