PDB entry 3rrm

View 3rrm on RCSB PDB site
Description: S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Class: hydrolase
Keywords: RecA, DEAD-box, HEAT-repeat, beta-propeller, ATPase, Helicase, mRNA-export, Nuclear Pore, HYDROLASE
Deposited on 2011-04-29, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DBP5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DBP5, RAT8, YOR046C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20449 (Start-394)
      • engineered mutation (239)
    Domains in SCOPe 2.07: d3rrma1, d3rrma2
  • Chain 'B':
    Compound: Nucleoporin GLE1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BRR3, D1049, GLE1, RSS1, YDL207W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12315 (2-296)
      • engineered mutation (95)
  • Chain 'C':
    Compound: Nucleoporin NUP159
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NUP158, NUP159, RAT7, YIL115C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40477 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3rrmc1, d3rrmc2
  • Heterogens: ADP, IHP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rrmA (A:)
    gamaksfdelglapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaa
    fsltmltrvnpedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqi
    naqvivgtpgtvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtql
    vlfsatfadavrqyakkivpnantlelqtnevnvdaikqlymdckneadkfdvltelygv
    mtigssiifvatkktanvlygklkseghevsilhgdlqtqerdrliddfregrskvlitt
    nvlargidiptvsmvvnydlptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfn
    ilsaiqkyfgdiemtrvptddwdevekivkkvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rrmA (A:)
    glapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsltmltrvn
    pedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaqvivgtpg
    tvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlfsatfada
    vrqyakkivpnantlelvnvdaikqlymdckneadkfdvltelygvmtigssiifvatkk
    tanvlygklkseghevsilhgdlqtqerdrliddfregrskvlittndiptvsmvvnydl
    ptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptd
    dwdevekivkkvlkd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rrmC (C:)
    gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
    vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
    tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
    drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
    evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
    cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdti
    erlplvyilnnegslqivglfhvaaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rrmC (C:)
    gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
    vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
    tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
    drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
    evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
    cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtrlplvyilnne
    gslqivglfh