PDB entry 3rrl

View 3rrl on RCSB PDB site
Description: Complex structure of 3-oxoadipate coA-transferase subunit A and B from Helicobacter pylori 26695
Class: transferase
Keywords: MCSG,PSI-biology, Structural Genomics, Midwest Center for Structural Genomics, 3-oxoadipate coA-transferase subunit A and B, TRANSFERASE
Deposited on 2011-04-29, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
    Species: Helicobacter pylori [TaxId:210]
    Gene: scoA, HP_0691
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rrla_
  • Chain 'B':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
    Species: Helicobacter pylori [TaxId:210]
    Gene: scoB, HP_0692
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
    Species: Helicobacter pylori [TaxId:210]
    Gene: scoA, HP_0691
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rrlc_
  • Chain 'D':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
    Species: Helicobacter pylori [TaxId:210]
    Gene: scoB, HP_0692
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rrlA (A:)
    snamnkvitdldkalsalkdgdtilvggfglcgipeyaidyiykkgikdlivvsnncgvd
    dfglgillekkqikkiiasyvgenkifesqmlngeievvltpqgtlaenlhaggagipay
    ytptgvgtliaqgkesrefngkeyileraitgdyglikayksdtlgnlvfrktarnfnpl
    camaakicvaeveeivpageldpdeihlpgiyvqhiykgekfekriekittrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rrlA (A:)
    mnkvitdldkalsalkdgdtilvggfglcgipeyaidyiykkgikdlivvsnncgvddfg
    lgillekkqikkiiasyvgenkifesqmlngeievvltpqgtlaenlhaggagipayytp
    tgvgtliaqgkesrefngkeyileraitgdyglikayksdtlgnlvfrktarnfnplcam
    aakicvaeveeivpageldpdeihlpgiyvqhiykgekfekriekittrs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rrlC (C:)
    snamnkvitdldkalsalkdgdtilvggfglcgipeyaidyiykkgikdlivvsnncgvd
    dfglgillekkqikkiiasyvgenkifesqmlngeievvltpqgtlaenlhaggagipay
    ytptgvgtliaqgkesrefngkeyileraitgdyglikayksdtlgnlvfrktarnfnpl
    camaakicvaeveeivpageldpdeihlpgiyvqhiykgekfekriekittrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rrlC (C:)
    nkvitdldkalsalkdgdtilvggfglcgipeyaidyiykkgikdlivvsnncgvddfgl
    gillekkqikkiiasyvgenkifmlngeievvltpqgtlaenlhaggagipayytptgvg
    tliaqgkesrefngkeyileraitgdyglikayksdtlgnlvfrktarnfnplcamaaki
    cvaeveeivpageldpdeihlpgiyvqhiykgekfekriekittrs
    

  • Chain 'D':
    No sequence available.