PDB entry 3rqi

View 3rqi on RCSB PDB site
Description: Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Class: transcription
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, response regulator protein, phosphorylated aspartic acid, calcium ion, TRANSCRIPTION
Deposited on 2011-04-28, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_0384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rqia_
  • Heterogens: CA, CIT, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rqiA (A:)
    gpgsmsdknflviddnevfagtlarglerrgyavrqahnkdealklagaekfefitvdlh
    lgndsglsliaplcdlqpdarilvltgyasiatavqavkdgadnylakpanvesilaalq
    tnasevqaeealenpvvlsvdrlewehiqrvlaennnnisataralnmhrrtlqrklakk
    pvrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rqiA (A:)
    dknflviddnevfagtlarglerrgyavrqahnkdealklagaekfefitvdlhlgndsg
    lsliaplcdlqpdarilvltgyasiatavqavkdgadnylakpanvesilaalqtnasev
    qaeealenpvvlslewehiqrvlaennnnisataralnmhrrtlqrklak