PDB entry 3rpq

View 3rpq on RCSB PDB site
Description: Domain-domain flexibility leads to allostery within the camp receptor protein (CRP)
Class: transcription regulator
Keywords: camp receptor protein (crp), allostery, DNA binding cyclic amp, transcription regulator, catabolite activator protein (cap), DNA binding protein
Deposited on 2011-04-27, released 2012-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: b3357, cap, crp, csm, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (62)
    Domains in SCOPe 2.04: d3rpqa1, d3rpqa2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: b3357, cap, crp, csm, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (62)
    Domains in SCOPe 2.04: d3rpqb1, d3rpqb2
  • Heterogens: CMP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rpqA (A:)
    mvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkem
    ilfylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaq
    marrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcs
    retvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rpqA (A:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilfylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rpqB (B:)
    mvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkem
    ilfylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaq
    marrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcs
    retvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rpqB (B:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilfylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgktivvygt