PDB entry 3rpi

View 3rpi on RCSB PDB site
Description: Crystal Structure of Fab from 3BNC60, Highly Potent anti-HIV Antibody
Class: immune system
Keywords: IgG, glycosylation, IMMUNE SYSTEM
Deposited on 2011-04-26, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain from highly potent anti-HIV neutralizing antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RPI
  • Chain 'B':
    Compound: Light chain from highly potent anti-HIV neutralizing antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RPI
    Domains in SCOPe 2.07: d3rpib1, d3rpib2
  • Chain 'H':
    Compound: Heavy chain from highly potent anti-HIV neutralizing antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RPI
  • Chain 'L':
    Compound: Light chain from highly potent anti-HIV neutralizing antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RPI
    Domains in SCOPe 2.07: d3rpil1, d3rpil2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rpiB (B:)
    diqmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsg
    rrwgqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rpiB (B:)
    qmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsgrr
    wgqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksgta
    svvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhk
    vyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3rpiL (L:)
    diqmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsg
    rrwgqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rpiL (L:)
    qmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsgrr
    wgqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksgta
    svvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhk
    vyacevthqglsspvtksfnrge