PDB entry 3ros

View 3ros on RCSB PDB site
Description: Crystal structure of NAD-dependent aldehyde dehydrogenase from Lactobacillus acidophilus
Class: oxidoreductase
Keywords: NYSGRC, PSI-BIOLOGY, Structural Genomics, New York Structural Genomics Research Consortium, succinic semialdehyde dehydrogenase, NAD dependent, OXIDOREDUCTASE
Deposited on 2011-04-26, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent aldehyde dehydrogenase
    Species: Lactobacillus acidophilus [TaxId:1579]
    Gene: ssdh, LBA1632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rosa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rosA (A:)
    mvmskyqsvnpytneafasydnptskqideainlahalykkwrheepasraeilhdiana
    lkehedelakmmtlemgkllseskeevelcvsicnyyadhgpemlkptklnsdlgnayyl
    kqstgvimacepwnfplyqvirvfapnfivgnpillkhahnvpgsaaltakiikragape
    gslinlypsydqladiiadpriqgvaltgserggsavaeaagknlkkstmelggndafiv
    lddadpqvlrnvlndartyndgqvctsskriiveksrydevlhelknvfsnlkagdplea
    dttlppmnsekakekleaqvkeaidagakvfyqypeidskgaffrptiltdiakdnpvfd
    kevfgpiaevfvveddnaaiqlandssyglgssvigsdidrakkvsaqietgmtvingrw
    itsgelpfggikksgygrelsglglmafvnehlvidvtknnqaenlyfqshhhhhhwshp
    qfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rosA (A:)
    mskyqsvnpytneafasydnptskqideainlahalykkwrheepasraeilhdianalk
    ehedelakmmtlemgkllseskeevelcvsicnyyadhgpemlkptklnsdlgnayylkq
    stgvimacepwnfplyqvirvfapnfivgnpillkhahnvpgsaaltakiikragapegs
    linlypsydqladiiadpriqgvaltgserggsavaeaagknlkkstmelggndafivld
    dadpqvlrnvlndartyndgqvctsskriiveksrydevlhelknvfsnlkagdpleadt
    tlppmnsekakekleaqvkeaidagakvfyqypeidskgaffrptiltdiakdnpvfdke
    vfgpiaevfvveddnaaiqlandssyglgssvigsdidrakkvsaqietgmtvingrwit
    sgelpfggikksgygrelsglglmafvnehlvidvtknn