PDB entry 3ro8

View 3ro8 on RCSB PDB site
Description: Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2
Class: Hydrolase
Keywords: glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, Xylanase, Hydrolase
Deposited on 2011-04-25, released 2012-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.144
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8a1, d3ro8a2
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8b1, d3ro8b2
  • Chain 'C':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3ro8c1, d3ro8c2
  • Chain 'D':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8d1, d3ro8d2
  • Chain 'E':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8e1, d3ro8e2
  • Chain 'F':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8f1, d3ro8f2
  • Chain 'G':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8g1, d3ro8g2
  • Chain 'H':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d3ro8h1, d3ro8h2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ro8A (A:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8A (A:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar
    vtfw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ro8B (B:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8B (B:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar
    vtfw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ro8C (C:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8C (C:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagtlpenlavgqaylyaqlfklykehadhiarvt
    fw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ro8D (D:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8D (D:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagtlpenlavgqaylyaqlfklykehadhiarvtf
    w
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ro8E (E:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8E (E:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagtlpenlavgqaylyaqlfklykehadhiarvtf
    w
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ro8F (F:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8F (F:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar
    vtfw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ro8G (G:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8G (G:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar
    vtfw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ro8H (H:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro8H (H:)
    shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
    taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
    vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
    npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
    dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar
    vtfw