PDB entry 3rnq

View 3rnq on RCSB PDB site
Description: Crystal structure of the complex between the extracellular domains of mouse PD-1 mutant and PD-L2
Class: immune system
Keywords: PD-1-mutant, PD-L2; B7-DC; Programmed death-1 Ligand 2, complex, costimulatory, IMMUNE SYSTEM
Deposited on 2011-04-22, released 2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pd1, Pdcd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02242 (0-End)
      • engineered mutation (49)
      • engineered mutation (94)
    Domains in SCOPe 2.05: d3rnqa_
  • Chain 'B':
    Compound: Programmed cell death 1 ligand 2
    Species: Mus musculus [TaxId:10090]
    Gene: B7dc, Btdc, Cd273, Murine, Pdcd1lg2, Pdl2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rnqA (A:)
    sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
    rfqiiqlpnrhdfhmnildtrrndsgiylcgaisrhpkakieespgaelvvterile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rnqA (A:)
    sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
    rfqiiqlpnrhdfhmnildtrrndsgiylcgaisrhpkakieespgaelvvt
    

  • Chain 'B':
    No sequence available.