PDB entry 3rnk
View 3rnk on RCSB PDB site
Description: Crystal structure of the complex between mouse PD-1 mutant and PD-L2 IgV domain
Class: immune system
Keywords: PD-1; PD-L2; B7-DC; Programmed death-1 Ligand 2, complex, costimulatory, IgV, IMMUNE SYSTEM
Deposited on
2011-04-22, released
2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated
2013-12-25, with a file datestamp of
2013-12-20.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.197
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Programmed cell death protein 1
Species: Mus musculus [TaxId:10090]
Gene: Pd1, Pdcd1
Database cross-references and differences (RAF-indexed):
- Uniprot Q02242 (0-End)
- engineered mutation (49)
- engineered mutation (98)
Domains in SCOPe 2.05: d3rnka_ - Chain 'B':
Compound: Programmed cell death 1 ligand 2
Species: Mus musculus [TaxId:10090]
Gene: B7dc, Btdc, Cd273, Murine, Pdcd1lg2, Pdl2
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3rnkA (A:)
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvterile
Sequence, based on observed residues (ATOM records): (download)
>3rnkA (A:)
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt
- Chain 'B':
No sequence available.