PDB entry 3rnj

View 3rnj on RCSB PDB site
Description: Crystal structure of the SH3 domain from IRSp53 (BAIAP2)
Class: protein binding
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Beta barrel, Protein interaction domain, Proline-rich motifs, PROTEIN BINDING
Deposited on 2011-04-22, released 2011-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Brain-specific angiogenesis inhibitor 1-associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BAIAP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQB8 (5-66)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d3rnja1, d3rnja2
  • Heterogens: EDT, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3rnjA (A:)
gplgsgrmrvkaifshaagdnstllsfkegdlitllvpeardgwhygesektkmrgwfpf
sytrvld