PDB entry 3rn4

View 3rn4 on RCSB PDB site
Description: Crystal structure of iron-substituted Sod2 from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: Mitochondrial manganese superoxide dismutase, Iron-binding, Mitochondrion, OXIDOREDUCTASE
Deposited on 2011-04-21, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rn4a1, d3rn4a2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rn4A (A:)
    lsttarrtkvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdll
    akepspanarkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfg
    sldelikltntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidaweh
    ayylqyqnkkadyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn4A (A:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdag