PDB entry 3rn0

View 3rn0 on RCSB PDB site
Description: Crystal Structure of the W199K-MauG/pre-Methylamine Dehydrogenase Complex
Class: Oxidoreductase/electron transport
Keywords: MauG, methylamine dehydrogenase, c-heme, quinone cofactor, ELECTRON TRANSPORT, Oxidoreductase-electron transport complex
Deposited on 2011-04-21, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (198)
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (198)
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4733
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rn0c_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rn0d_
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4733
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rn0e_
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rn0f_
  • Heterogens: CA, NA, HEC, P6G, PG4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rn0C (C:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn0C (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rn0D (D:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn0D (D:)
    qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
    vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
    prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
    tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
    qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
    rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
    nqlghgpqvittadmg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3rn0E (E:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn0E (E:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3rn0F (F:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn0F (F:)
    qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
    vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
    prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
    tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
    qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
    rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
    nqlghgpqvittadmg