PDB entry 3rlp

View 3rlp on RCSB PDB site
Description: Co-crystal structure of the HSP90 ATP binding domain in complex with 4-(2,4-dichloro-5-methoxyphenyl)-6-methylpyrimidin-2-amine
Class: chaperone
Keywords: chaperone
Deposited on 2011-04-20, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (Start-217)
      • expression tag (218)
    Domains in SCOPe 2.07: d3rlpa1, d3rlpa2
  • Chain 'B':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (1-217)
      • expression tag (218-222)
    Domains in SCOPe 2.07: d3rlpb1, d3rlpb2
  • Heterogens: 3RP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rlpA (A:)
    mdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdp
    skldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagad
    ismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvi
    lhlkedqteyleerrikeivkkhsqfigypitlfvekelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rlpA (A:)
    qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpsk
    ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis
    migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
    lkedqteyleerrikeivkkhsqfigypitlfvekel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rlpB (B:)
    mdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdp
    skldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagad
    ismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvi
    lhlkedqteyleerrikeivkkhsqfigypitlfvekelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rlpB (B:)
    dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
    kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtitkafmealqagadismig
    qfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlke
    dqteyleerrikeivkkhsqfigypitlfvekelehhh