PDB entry 3rku

View 3rku on RCSB PDB site
Description: Substrate Fingerprint and the Structure of NADP+ Dependent Serine Dehydrogenase from Saccharomyces cerevisiae complexed with NADP+
Class: oxidoreductase
Keywords: substrate fingerprint, short chain oxidoreductase, Rossmann Fold, OXIDOREDUCTASE
Deposited on 2011-04-18, released 2011-06-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase YMR226C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YM9959.08C, YMR226C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05016 (20-286)
      • expression tag (19)
    Domains in SCOPe 2.04: d3rkua_
  • Chain 'B':
    Compound: Oxidoreductase YMR226C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YM9959.08C, YMR226C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05016 (20-286)
      • expression tag (19)
    Domains in SCOPe 2.04: d3rkub_
  • Chain 'C':
    Compound: Oxidoreductase YMR226C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YM9959.08C, YMR226C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05016 (20-286)
      • expression tag (19)
    Domains in SCOPe 2.04: d3rkuc_
  • Chain 'D':
    Compound: Oxidoreductase YMR226C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YM9959.08C, YMR226C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05016 (20-286)
      • expression tag (19)
    Domains in SCOPe 2.04: d3rkud_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rkuA (A:)
    mgsshhhhhhssflvprgshmsqgrkaaerlakktvlitgasagigkataleyleasngd
    mklilaarrlekleelkktidqefpnakvhvaqlditqaekikpfienlpqefkdidilv
    nnagkalgsdrvgqiatediqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrd
    ayptgsiycaskfavgaftdslrkelintkirviliapglvetefslvryrgneeqaknv
    ykdttplmaddvadlivyatsrkqntviadtlifptnqasphhifrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkuA (A:)
    hmsqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkt
    idqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiated
    iqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaft
    dslrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivya
    tsrkqntviadtlifptnqasphhifrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rkuB (B:)
    mgsshhhhhhssflvprgshmsqgrkaaerlakktvlitgasagigkataleyleasngd
    mklilaarrlekleelkktidqefpnakvhvaqlditqaekikpfienlpqefkdidilv
    nnagkalgsdrvgqiatediqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrd
    ayptgsiycaskfavgaftdslrkelintkirviliapglvetefslvryrgneeqaknv
    ykdttplmaddvadlivyatsrkqntviadtlifptnqasphhifrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkuB (B:)
    hmsqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkt
    idqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiated
    iqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaft
    dslrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivya
    tsrkqntviadtlifptnqasphhifrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rkuC (C:)
    mgsshhhhhhssflvprgshmsqgrkaaerlakktvlitgasagigkataleyleasngd
    mklilaarrlekleelkktidqefpnakvhvaqlditqaekikpfienlpqefkdidilv
    nnagkalgsdrvgqiatediqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrd
    ayptgsiycaskfavgaftdslrkelintkirviliapglvetefslvryrgneeqaknv
    ykdttplmaddvadlivyatsrkqntviadtlifptnqasphhifrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkuC (C:)
    hmsqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkt
    idqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiated
    iqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaft
    dslrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivya
    tsrkqntviadtlifptnqasphhifrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rkuD (D:)
    mgsshhhhhhssflvprgshmsqgrkaaerlakktvlitgasagigkataleyleasngd
    mklilaarrlekleelkktidqefpnakvhvaqlditqaekikpfienlpqefkdidilv
    nnagkalgsdrvgqiatediqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrd
    ayptgsiycaskfavgaftdslrkelintkirviliapglvetefslvryrgneeqaknv
    ykdttplmaddvadlivyatsrkqntviadtlifptnqasphhifrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkuD (D:)
    hmsqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkt
    idqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiated
    iqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaft
    dslrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivya
    tsrkqntviadtlifptnqasphhifrg