PDB entry 3rkd

View 3rkd on RCSB PDB site
Description: Hepatitis E Virus E2s domain (Genotype I) in complex with a neutralizing antibody
Class: viral protein/immune system
Keywords: Hepatitis E virus capsid protein, neutralizing antibody, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2011-04-18, released 2011-06-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Hepatitis E virus [TaxId:12461]
    Gene: ORF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0VX51 (0-144)
      • engineered mutation (73)
      • expression tag (145)
  • Chain 'B':
    Compound: capsid protein
    Species: Hepatitis E virus [TaxId:12461]
    Gene: ORF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0VX51 (Start-144)
      • engineered mutation (73)
      • expression tag (145)
  • Chain 'C':
    Compound: monoclonal antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3RKD (0-End)
    Domains in SCOPe 2.03: d3rkdc1, d3rkdc2
  • Chain 'D':
    Compound: monoclonal antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3RKD (0-End)
  • Chain 'H':
    Compound: monoclonal antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3RKD (0-End)
  • Chain 'L':
    Compound: monoclonal antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3RKD (0-End)
    Domains in SCOPe 2.03: d3rkdl1, d3rkdl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rkdC (C:)
    diqmtqspaslsvsvgetvtitcraseiiysnlawyqqkqgkspqllvysatnlaegvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgnpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkdC (C:)
    diqmtqspaslsvsvgetvtitcraseiiysnlawyqqkqgkspqllvysatnlaegvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgnpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3rkdL (L:)
    diqmtqspaslsvsvgetvtitcraseiiysnlawyqqkqgkspqllvysatnlaegvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgnpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkdL (L:)
    diqmtqspaslsvsvgetvtitcraseiiysnlawyqqkqgkspqllvysatnlaegvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgnpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne