PDB entry 3rjy

View 3rjy on RCSB PDB site
Description: Crystal Structure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate
Class: hydrolase
Keywords: thermophilic enzymes, endo-beta-1,4-glucanase, thermostability, HYDROLASE
Deposited on 2011-04-15, released 2012-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase FnCel5A
    Species: Fervidobacterium nodosum [TaxId:381764]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D4PEB3 (Start-319)
      • conflict (10)
    Domains in SCOPe 2.06: d3rjya_
  • Heterogens: GLC, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rjyA (A:)
    mdqsvsnvdkmsafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvri
    pirwsahisekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlv
    eiwkqvaqafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpn
    wsnysyvrelklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirn
    hfkyvsewakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfg
    lydrwtktwieplttsalgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjyA (A:)
    msafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsahise
    kypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqvaqaf
    kdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyvrel
    klvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvsewak
    knnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtktwi
    eplttsalgk