PDB entry 3rjx

View 3rjx on RCSB PDB site
Description: Crystal Structure of Hyperthermophilic Endo-Beta-1,4-glucanase
Class: hydrolase
Keywords: thermophilic enzymes, endo-beta-1,4-glucanase, thermostability, HYDROLASE
Deposited on 2011-04-15, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase FnCel5A
    Species: Fervidobacterium nodosum [TaxId:381764]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rjxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rjxA (A:)
    mdqsvsnvdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvri
    pirwsahisekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlv
    eiwkqvaqafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpn
    wsnysyvrelklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirn
    hfkyvsewakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfg
    lydrwtktwieplttsalgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjxA (A:)
    vdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsah
    isekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqva
    qafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyv
    relklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvse
    wakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtk
    twieplttsalgk