PDB entry 3rjp

View 3rjp on RCSB PDB site
Description: Crystal structure of the DNA binding domain of CovR from Streptococcus pyogenes
Class: DNA binding protein
Keywords: winged helix-turn-helix, DNA binding, DNA BINDING PROTEIN
Deposited on 2011-04-15, released 2012-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.201
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CovR
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: covR, csrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87527 (1-95)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d3rjpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3rjpA (A:)
myrdlvlnpqnrsvnrgddeisltkreydllnilmtnmnrvmtreellsnvwkydeavet
nvvdvyirylrgkidipgkesyiqtvrgmgyvirek