PDB entry 3rjl

View 3rjl on RCSB PDB site
Description: Crystal structure of 1-pyrroline-5-carboxylate dehydrogenase from Bacillus licheniformis (Target NYSGRC-000337)
Class: oxidoreductase
Keywords: proline oxidation, redox control, apoptosis, nad binding, oxidoreductase, psi-biology, protein structure initiative, new york structural genomics research consortium (nysgrc)
Deposited on 2011-04-15, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjla_
  • Chain 'B':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjlb_
  • Chain 'C':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjlc_
  • Chain 'D':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjld_
  • Chain 'E':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjle_
  • Chain 'F':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjlf_
  • Chain 'G':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjlg_
  • Chain 'H':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Bacillus licheniformis [TaxId:279010]
    Gene: rocA, BLi00374, BL01710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjlh_
  • Heterogens: CD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rjlA (A:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlA (A:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rjlB (B:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlB (B:)
    tpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpanke
    evvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvk
    eagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippw
    nflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaev
    gdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdi
    elaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgp
    vidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpv
    vafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgy
    hpfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rjlC (C:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlC (C:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rjlD (D:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlD (D:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3rjlE (E:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlE (E:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3rjlF (F:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlF (F:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3rjlG (G:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlG (G:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3rjlH (H:)
    mttpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpan
    keevvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsall
    vkeagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvip
    pwnflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsga
    evgdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedc
    dielaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvym
    gpvidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifg
    pvvafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktisemfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjlH (H:)
    pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee
    vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke
    agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn
    flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg
    dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie
    laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv
    idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv
    afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh
    pfggfkmsgtdskaggpdylalhmqaktisemf