PDB entry 3rix

View 3rix on RCSB PDB site
Description: 1.7A resolution structure of a firefly luciferase-Aspulvinone J inhibitor complex
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: oxidoreductase, monooxygenase, photoprotein, luminescence, aspulvinone, natural product extracts, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-04-14, released 2011-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Luciferin 4-monooxygenase
    Species: Photinus pyralis [TaxId:7054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rixa_
  • Heterogens: 923, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rixA (A:)
    medaknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfems
    vrlaeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmni
    sqptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneyd
    fvpesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsv
    vpfhhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstl
    idkydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpg
    avgkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhs
    gdiaywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagel
    paavvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireili
    kakkggkskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rixA (A:)
    daknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvr
    laeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisq
    ptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfv
    pesfdrdktialimnslpkgvalphrtacvrfshardpifgnqiipdtailsvvpfhhgf
    gmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydls
    nlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvp
    ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
    edehffiv