PDB entry 3ris

View 3ris on RCSB PDB site
Description: Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
Class: hydrolase
Keywords: alpha-beta-alpha fold, cysteine protease, thiol hydrolase, deubiquitinating enzyme, ubiquitin hydrolase, hydrolase
Deposited on 2011-04-14, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3risa_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3risb_
  • Chain 'C':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3risc_
  • Chain 'D':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3risd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3risA (A:)
    gplgsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhglifl
    fkwqpgeepagsvvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefk
    efsqsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrl
    yeldglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqki
    aelqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3risA (A:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarqqmfefdtkdafhfvsyvpvngrlyeldglregpidlgacn
    qddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqkiaelq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3risB (B:)
    gplgsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhglifl
    fkwqpgeepagsvvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefk
    efsqsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrl
    yeldglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqki
    aelqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3risB (B:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarqqmfefdtedafhfvsyvpvngrlyeldglregpidlgacn
    qddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqkiaelq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3risC (C:)
    gplgsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhglifl
    fkwqpgeepagsvvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefk
    efsqsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrl
    yeldglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqki
    aelqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3risC (C:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarqqmfefdafhfvsyvpvngrlyeldglregpidlgacnqdd
    wisavrpviekriqkysegeirfnlmaivsdrkmiyeqkiaelq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3risD (D:)
    gplgsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhglifl
    fkwqpgeepagsvvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefk
    efsqsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrl
    yeldglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqki
    aelqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3risD (D:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfarqqmfefafhfvsyvpvngrlyeldglregpidlgacnqddw
    isavrpviekriqkysegeirfnlmaivsdrkmiyeqkiael