PDB entry 3ri2

View 3ri2 on RCSB PDB site
Description: Crystal structure of PadR family transcriptional regulator from Eggerthella lenta DSM 2243
Class: transcription regulator
Keywords: PSI-BIOLOGY, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, transcriptional regulator, PadR, TRANSCRIPTION REGULATOR
Deposited on 2011-04-12, released 2011-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: Eggerthella lenta [TaxId:479437]
    Gene: Elen_1533
    Database cross-references and differences (RAF-indexed):
    • Uniprot C8WHB0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3ri2a1, d3ri2a2
  • Chain 'B':
    Compound: Transcriptional regulator, PadR-like family
    Species: Eggerthella lenta [TaxId:479437]
    Gene: Elen_1533
    Database cross-references and differences (RAF-indexed):
    • Uniprot C8WHB0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3ri2b1, d3ri2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ri2A (A:)
    snamayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmr
    rlesqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletngedreh
    aer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ri2A (A:)
    amayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrl
    esqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ri2B (B:)
    snamayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmr
    rlesqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletngedreh
    aer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ri2B (B:)
    amayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipintlyplmrrles
    qgllasewdnggkprkyyrttdeglrvlreveaqwhvlcdgvgklletn