PDB entry 3rhx

View 3rhx on RCSB PDB site
Description: Crystal structure of the catalytic domain of FGFR1 kinase in complex with ARQ 069
Class: transferase/transferase inhibitor
Keywords: FGFR1 kinase, FGFR2 kinase, inactive conformation, kinase-inhibitor complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-04-12, released 2011-05-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (28)
    Domains in SCOPe 2.03: d3rhxa_
  • Chain 'B':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (1-End)
      • engineered mutation (28)
    Domains in SCOPe 2.03: d3rhxb_
  • Heterogens: 3RH, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rhxA (A:)
    gseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
    gleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmki
    adfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggs
    pypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriva
    ltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhxA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyyk
    kttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllke
    ghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rhxB (B:)
    gseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
    gleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmki
    adfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggs
    pypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriva
    ltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhxB (B:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkttngrlpvkw
    mapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnct
    nelymmmrdcwhavpsqrptfkqlvedldrivalt