PDB entry 3rhq

View 3rhq on RCSB PDB site
Description: Crystal structure of the C707A mutant of C-Terminal domain of 10'FORMYLTETRAHYDROFOLATE DEHYDROGENASE in complex with NADP
Class: oxidoreductase
Keywords: fdh, oxidoreductase
Deposited on 2011-04-12, released 2011-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde dehydrogenase 1 family, member L1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HZB2 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.06: d3rhqa_
  • Chain 'B':
    Compound: Aldehyde dehydrogenase 1 family, member L1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HZB2 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.06: d3rhqb_
  • Chain 'C':
    Compound: Aldehyde dehydrogenase 1 family, member L1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HZB2 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.06: d3rhqc_
  • Chain 'D':
    Compound: Aldehyde dehydrogenase 1 family, member L1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HZB2 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.06: d3rhqd_
  • Heterogens: NAP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rhqA (A:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenaiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhqA (A:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rhqB (B:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenaiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhqB (B:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rhqC (C:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenaiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhqC (C:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rhqD (D:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenaiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhqD (D:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey