PDB entry 3rh9

View 3rh9 on RCSB PDB site
Description: The crystal structure of oxidoreductase from Marinobacter aquaeolei
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, oxidoreductase, ABM20716.1
Deposited on 2011-04-11, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.191
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate-semialdehyde dehydrogenase (NAD(P)(+))
    Species: Marinobacter aquaeolei [TaxId:351348]
    Gene: Maqu_3647
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rh9a_
  • Chain 'B':
    Compound: Succinate-semialdehyde dehydrogenase (NAD(P)(+))
    Species: Marinobacter aquaeolei [TaxId:351348]
    Gene: Maqu_3647
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rh9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rh9A (A:)
    mvmiespllenltgyiggrwkdsaggatfdvynpatgsviakvpsmpeedvvaaveagqs
    alrltnpwpietrrkwledirdglkenreeigrilcmehgkpwkeaqgevdyaagffdyc
    akhisaldshtipekpkdctwtvhyrpvgvtglivpwnfpigmiakklsaalaagcpsvi
    kpasetpltmiaffsvmdkldlpdgmvnlvmgkasvigkvlcehkdvpmlsftgstevgr
    klivdtaeqvkklalelggnapfivfddadleaaadnliankfrgggqtcvcanrifvhe
    kvadafgqklaervnkmtvgdgmndgidigplinkqgfdkvkrhlqdaldkgaslvagkq
    paelgdglffpptvvqgvdremccyqeetfgplvpmalfrteeevidagndtefglasyv
    ftadaeraqrvaaglrfghvgwntgtgptpeapfggmkasgigreggleglfefveaqtv
    prgfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rh9A (A:)
    miespllenltgyiggrwkdsaggatfdvynpatgsviakvpsmpeedvvaaveagqsal
    rltnpwpietrrkwledirdglkenreeigrilcmehgkpwkeaqgevdyaagffdycak
    hisaldshtipekpkdctwtvhyrpvgvtglivpwnfpigmiakklsaalaagcpsvikp
    asetpltmiaffsvmdkldlpdgmvnlvmgkasvigkvlcehkdvpmlsftgstevgrkl
    ivdtaeqvkklalelggnapfivfddadleaaadnliankfrgggqtcvcanrifvhekv
    adafgqklaervnkmtvgdgmndgidigplinkqgfdkvkrhlqdaldkgaslvagkqpa
    elgdglffpptvvqgvdremccyqeetfgplvpmalfrteeevidagndtefglasyvft
    adaeraqrvaaglrfghvgwntgtgptpeapfggmkasgigreggleglfefveaqtvpr
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rh9B (B:)
    mvmiespllenltgyiggrwkdsaggatfdvynpatgsviakvpsmpeedvvaaveagqs
    alrltnpwpietrrkwledirdglkenreeigrilcmehgkpwkeaqgevdyaagffdyc
    akhisaldshtipekpkdctwtvhyrpvgvtglivpwnfpigmiakklsaalaagcpsvi
    kpasetpltmiaffsvmdkldlpdgmvnlvmgkasvigkvlcehkdvpmlsftgstevgr
    klivdtaeqvkklalelggnapfivfddadleaaadnliankfrgggqtcvcanrifvhe
    kvadafgqklaervnkmtvgdgmndgidigplinkqgfdkvkrhlqdaldkgaslvagkq
    paelgdglffpptvvqgvdremccyqeetfgplvpmalfrteeevidagndtefglasyv
    ftadaeraqrvaaglrfghvgwntgtgptpeapfggmkasgigreggleglfefveaqtv
    prgfaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rh9B (B:)
    miespllenltgyiggrwkdsaggatfdvynpatgsviakvpsmpeedvvaaveagqsal
    rltnpwpietrrkwledirdglkenreeigrilcmehgkpwkeaqgevdyaagffdycak
    hisaldshtipekpkdctwtvhyrpvgvtglivpwnfpigmiakklsaalaagcpsvikp
    asetpltmiaffsvmdkldlpdgmvnlvmgkasvigkvlcehkdvpmlsftgstevgrkl
    ivdtaeqvkklalelggnapfivfddadleaaadnliankfrgggqtcvcanrifvhekv
    adafgqklaervnkmtvgdgmndgidigplinkqgfdkvkrhlqdaldkgaslvagkqpa
    elffpptvvqgvdremccyqeetfgplvpmalfrteeevidagndtefglasyvftadae
    raqrvaaglrfghvgwntgtgptpeapfggmkasgigreggleglfefveaqtvpr