PDB entry 3rgt

View 3rgt on RCSB PDB site
Description: Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with D-Arabinohydroxamate
Class: lyase
Keywords: enolase fold, D-MANNONATE DEHYDRATASE, D-Arabinohydroxamate, LYASE
Deposited on 2011-04-09, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3rgta1, d3rgta2, d3rgta3
  • Chain 'B':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3rgtb1, d3rgtb2, d3rgtb3
  • Chain 'C':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3rgtc1, d3rgtc2, d3rgtc3
  • Chain 'D':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3rgtd1, d3rgtd2, d3rgtd3
  • Heterogens: CO, EZ4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rgtA (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgtA (A:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rgtB (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgtB (B:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgiettygvyepadsslpaehvwsteky
    lnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqes
    lrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyh
    vrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflage
    spghgvdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rgtC (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgtC (C:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgislpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rgtD (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgtD (D:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw