PDB entry 3rgh

View 3rgh on RCSB PDB site
Description: Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens
Class: cell adhesion
Keywords: CELL ADHESION, CYTOSKELETON-COMPLEX, DISEASE MUTATION, IMMUNOGLOBULIN LIKE, FILAMIN, CYTOSKELETON, ACTIN-BINDING, CELL JUNCTION, CELL SHAPE, Immunoglobulin-like beta-sandwich, CD4, beta-mercaptoethanol adduct
Deposited on 2011-04-08, released 2011-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLN, FLN1, FLNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21333 (5-99)
      • expression tag (2-4)
    Domains in SCOPe 2.06: d3rgha1, d3rgha2
  • Chain 'B':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLN, FLN1, FLNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21333 (5-99)
      • expression tag (3-4)
    Domains in SCOPe 2.06: d3rghb1, d3rghb2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rghA (A:)
    gamdpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdh
    gdgthtityiplcpgaytvtikyggqpvpnfpsklqvepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rghA (A:)
    mdpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgd
    gthtityiplcpgaytvtikyggqpvpnfpsklqvepa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rghB (B:)
    gamdpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdh
    gdgthtityiplcpgaytvtikyggqpvpnfpsklqvepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rghB (B:)
    dpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgdg
    thtityiplcpgaytvtikyggqpvpnfpsklqvepa