PDB entry 3rgd

View 3rgd on RCSB PDB site
Description: Iron loaded frog M ferritin. Short soaking time
Class: oxidoreductase
Keywords: eukaryotic ferritin, four-helix bundle, ferroxidase, Oxidoreductase
Deposited on 2011-04-08, released 2012-04-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.175
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgda_
  • Chain 'B':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdb_
  • Chain 'C':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdc_
  • Chain 'D':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdd_
  • Chain 'E':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgde_
  • Chain 'F':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdf_
  • Chain 'G':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdg_
  • Chain 'H':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdh_
  • Chain 'I':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdi_
  • Chain 'J':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdj_
  • Chain 'K':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdk_
  • Chain 'L':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdl_
  • Chain 'M':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdm_
  • Chain 'N':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdn_
  • Chain 'O':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdo_
  • Chain 'P':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdp_
  • Chain 'Q':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdq_
  • Chain 'R':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdr_
  • Chain 'S':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgds_
  • Chain 'T':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdt_
  • Chain 'U':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdu_
  • Chain 'V':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdv_
  • Chain 'W':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdw_
  • Chain 'X':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rgdx_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rgdA (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdA (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rgdB (B:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdB (B:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rgdC (C:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdC (C:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rgdD (D:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdD (D:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3rgdE (E:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdE (E:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3rgdF (F:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdF (F:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3rgdG (G:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdG (G:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3rgdH (H:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdH (H:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3rgdI (I:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdI (I:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3rgdJ (J:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdJ (J:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3rgdK (K:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdK (K:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3rgdL (L:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdL (L:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3rgdM (M:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdM (M:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3rgdN (N:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdN (N:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3rgdO (O:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdO (O:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3rgdP (P:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdP (P:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3rgdQ (Q:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdQ (Q:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3rgdR (R:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdR (R:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3rgdS (S:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdS (S:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3rgdT (T:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdT (T:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3rgdU (U:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdU (U:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3rgdV (V:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdV (V:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3rgdW (W:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdW (W:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3rgdX (X:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgdX (X:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv