PDB entry 3rfc

View 3rfc on RCSB PDB site
Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP
Class: ligase
Keywords: ADP forming ligase, dimerization of two D-alanines, LIGASE
Deposited on 2011-04-06, released 2011-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanine--D-alanine ligase 1
    Species: Xanthomonas oryzae pv. oryzae [TaxId:342109]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2P8P8
      • engineered mutation (343)
    Domains in SCOPe 2.06: d3rfca1, d3rfca2
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rfcA (A:)
    hhhhhhhssenlyfqghmrkirvglifggksaehevslqsarnildaldpqrfepvligi
    dkqgqwhvndpdsfllhaddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvf
    pivhgtlgedgslqgllrmanlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdr
    htaahadvdtliaqlglplfvkpanqgssvgvsqvrtadafaaalalalaydhkvlveaa
    vagreiecavlgnavphasvcgevvvhdafysyatkyisehgaeivipadidaqtqqriq
    qiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrgli
    trlielalerhtddqllrsavelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rfcA (A:)
    rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
    ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma
    nlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplf
    vkpanqgssvgvsqvrtadafaaalalalaydhkvlveaavagreiecavlgnavphasv
    cgevvveivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlp
    gftrisvypklwqasgldyrglitrlielalerhtddqllrsav