PDB entry 3reo

View 3reo on RCSB PDB site
Description: Monolignol O-methyltransferase (MOMT)
Class: transferase
Keywords: directed evolution, SATURATION MUTAGENESIS, regioselectivity, TRANSFERASE
Deposited on 2011-04-04, released 2012-03-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.03: d3reoa1, d3reoa2
  • Chain 'B':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.03: d3reob1, d3reob2
  • Chain 'C':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.03: d3reoc1, d3reoc2
  • Chain 'D':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.03: d3reod1, d3reod2
  • Heterogens: SAH, EUG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3reoA (A:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reoA (A:)
    sdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpea
    pvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapflllatd
    kvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitmkkile
    myngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdmf
    dgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkvv
    ihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3reoB (B:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reoB (B:)
    ssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
    apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapflllat
    dkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitmkkil
    emyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdm
    fdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkv
    vihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3reoC (C:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reoC (C:)
    eiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvpgyispaeiaaql
    pttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslap
    flllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnsti
    tmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgve
    hlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdp
    siatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3reoD (D:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reoD (D:)
    iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvgyispaeiaaqlpt
    tnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapfl
    llatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitm
    kkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehl
    ggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsi
    atkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt