PDB entry 3rdk

View 3rdk on RCSB PDB site
Description: Protein crystal structure of xylanase A1 of Paenibacillus sp. JDR-2
Class: hydrolase
Keywords: (beta/alpha)8 barrel, GH10, xylanase, HYDROLASE
Deposited on 2011-04-01, released 2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.147
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. JDR-2 [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rdka_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: Paenibacillus sp. JDR-2 [TaxId:324057]
    Gene: Pjdr2_0221
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6CRV0 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.06: d3rdkb1, d3rdkb2
  • Heterogens: GOL, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rdkA (A:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdkA (A:)
    aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
    damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
    hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
    wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
    klslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiarvtf
    wgmddntswraennpllfdknlqakpayygvid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rdkB (B:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdkB (B:)
    maplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftfta
    adamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvm
    khfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenp
    swniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdn
    vklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiarvt
    fwgmddntswraennpllfdknlqakpayygvid