PDB entry 3rdd

View 3rdd on RCSB PDB site
Description: Human Cyclophilin A Complexed with an Inhibitor
Class: isomerase/isomerase inhibitor
Keywords: beta barrel, prolyl cis/trans isomerase, cytosolic, inhibitor, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2011-04-01, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rdda_
  • Heterogens: EA4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rddA (A:)
    mghhhhhhssgrenlyfqgmvnptvffdiavdgeplgrvsfelfadkvpktaenfralst
    gekgfgykgscfhriipgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsma
    nagpntngsqffictaktewldgkhvvfgkvkegmniveamerfgsrngktskkitiadc
    gqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rddA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle