PDB entry 3rd2

View 3rd2 on RCSB PDB site
Description: NIP45 SUMO-like Domain 2
Class: Transcription
Keywords: SUMO-like domain 2, protein:protein interaction, Ubc9, Transcription
Deposited on 2011-03-31, released 2011-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.172
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NFATC2-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2IP, NIP45
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NCF5 (7-81)
      • expression tag (0-6)
    Domains in SCOPe 2.06: d3rd2a1, d3rd2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rd2A (A:)
    mhhhhhhsqqlqlrvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtk
    lsgrelpadlgmesgdlievwg