PDB entry 3rd1

View 3rd1 on RCSB PDB site
Description: Structure of an ADP ribosylation factor from Entamoeba histolytica HM-1:IMSS bound to Mg-GDP
Class: signaling protein
Keywords: GDP-ribosylation factor, small GTPase, ArfA1, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, SIGNALING PROTEIN
Deposited on 2011-03-31, released 2011-04-13
Made obsolete by 4y0v on 2015-03-04

The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.233
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_073470, EHI_137720
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rd1a_
  • Chain 'B':
    Compound: ADP-ribosylation factor
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_073470, EHI_137720
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rd1b_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rd1A (A:)
    gpgsmgswlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveykn
    isftvwdvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnai
    llvfankhdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rd1A (A:)
    swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
    dvggplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlp
    qamsisevteklglqtiknrkwycqtscatngdglyegldwladnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rd1B (B:)
    gpgsmgswlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveykn
    isftvwdvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnai
    llvfankhdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rd1B (B:)
    swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
    dvggyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlpqamsis
    evteklglqtiknrkwycqtscatngdglyegldwladnl