PDB entry 3rcp

View 3rcp on RCSB PDB site
Description: Crystal structure of the FAPP1 pleckstrin homology domain
Class: membrane protein
Keywords: FAPP1, PH domain, Lipid-binding, Membrane, MEMBRANE PROTEIN, seven-stranded-barrel capped by an helix at one edge, phospholipid Binding
Deposited on 2011-03-31, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family A member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: FAPP1, PLEKHA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HB20 (0-98)
      • engineered mutation (93)
      • expression tag (99-102)
    Domains in SCOPe 2.07: d3rcpa1, d3rcpa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rcpA (A:)
    megvlykwtnyltgwqprwfvldngilsyydsqddvckgskgsikmavceikvhsadntr
    meliipgeqhfymkavnaaerqrwlvalgsskasltdtrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rcpA (A:)
    megvlykwtnyltgwqprwfvldngilsyydsqdkgskgsikmavceikvhsadntrmel
    iipgeqhfymkavnaaerqrwlvalgsskasltdtrlvpr