PDB entry 3ra7

View 3ra7 on RCSB PDB site
Description: Bispecific digoxigenin binding antibodies for targeted payload delivery
Class: immune system
Keywords: Fab fragment, Antibody Engineering, Cancer, targeted payload delivery, IMMUNE SYSTEM
Deposited on 2011-03-27, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RA7 (0-End)
  • Chain 'I':
    Compound: Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RA7 (0-End)
  • Chain 'L':
    Compound: Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RA7 (0-End)
    Domains in SCOPe 2.07: d3ra7l1, d3ra7l2
  • Chain 'M':
    Compound: Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RA7 (0-End)
    Domains in SCOPe 2.07: d3ra7m1, d3ra7m2
  • Heterogens: DOG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ra7L (L:)
    dvqmtqstsslsaslgdrvtiscrasqdiknylnwyqqkpggtvklliyysstllsgvps
    rfsgrgsgtdfsltitnlerediatyfcqqsitlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ra7L (L:)
    dvqmtqstsslsaslgdrvtiscrasqdiknylnwyqqkpggtvklliyysstllsgvps
    rfsgrgsgtdfsltitnlerediatyfcqqsitlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3ra7M (M:)
    dvqmtqstsslsaslgdrvtiscrasqdiknylnwyqqkpggtvklliyysstllsgvps
    rfsgrgsgtdfsltitnlerediatyfcqqsitlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ra7M (M:)
    dvqmtqstsslsaslgdrvtiscrasqdiknylnwyqqkpggtvklliyysstllsgvps
    rfsgrgsgtdfsltitnlerediatyfcqqsitlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr