PDB entry 3r93

View 3r93 on RCSB PDB site
Description: Crystal structure of the chromo domain of M-phase phosphoprotein 8 bound to H3K9Me3 peptide
Class: cell cycle
Keywords: epigenetics, cell cycle, M-phase, chromodomain, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2011-03-24, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r93a_
  • Chain 'B':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r93b_
  • Chain 'C':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r93c_
  • Chain 'D':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r93d_
  • Chain 'E':
    Compound: H3K9Me3 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3R93 (Start-14)
  • Chain 'F':
    Compound: H3K9Me3 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3R93 (Start-14)
  • Chain 'G':
    Compound: H3K9Me3 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3R93 (Start-14)
  • Chain 'H':
    Compound: H3K9Me3 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3R93 (Start-14)
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r93A (A:)
    gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r93A (A:)
    dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r93B (B:)
    gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r93B (B:)
    dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r93C (C:)
    gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r93C (C:)
    dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r93D (D:)
    gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r93D (D:)
    edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.