PDB entry 3r8v

View 3r8v on RCSB PDB site
Description: CDK2 in complex with inhibitor RC-1-135
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-03-24, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r8va_
  • Heterogens: Z62, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r8vA (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8vA (A:)
    menfqkvekigegtygvvykarnkltgevvalkkirtegvpstaireisllkelnhpniv
    klldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvl
    hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav
    diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa
    rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl