PDB entry 3r8c

View 3r8c on RCSB PDB site
Description: Crystal structure of cytidylate kinase (Cmk) from Mycobacterium abscessus
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Mycobacterium, tuberculosis, water contaminant, chronic lung disease, rapid growing mycobacterium, pyrimidine nucleoside monophosphate kinase, phosphotransferase,, TRANSFERASE
Deposited on 2011-03-23, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: cmk, MAB_2371
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MB31 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3r8ca1, d3r8ca2
  • Chain 'B':
    Compound: Cytidylate kinase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: cmk, MAB_2371
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MB31 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3r8cb1, d3r8cb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r8cA (A:)
    gpgsmvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaia
    aatdqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrela
    essgavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqr
    rdhldstravsplrpaedalevdtsdmtqeqvvahlldlvrtragasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8cA (A:)
    smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
    dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
    gavvvegrdigtvvlpdadvkiyltasaqaraqrrnladvqrrdhlplrpaedalevdts
    dmtqeqvvahlldlvrtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r8cB (B:)
    gpgsmvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaia
    aatdqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrela
    essgavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqr
    rdhldstravsplrpaedalevdtsdmtqeqvvahlldlvrtragasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8cB (B:)
    smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
    dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
    gavvvegrdigtvvlpdadvkiyltasaqaraqrrnladvqrrdhldstravsplrpaed
    alevdtsdmtqeqvvahlldlvrtr