PDB entry 3r8b

View 3r8b on RCSB PDB site
Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8
Class: toxin/immune system
Keywords: immunoglobulin-like, OB-fold, TOXIN-IMMUNE SYSTEM complex
Deposited on 2011-03-23, released 2011-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.247
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552
• Chain 'B':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Chain 'C':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552
• Chain 'D':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
  Domains in SCOPe 2.01: d3r8bd_
• Chain 'E':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552
• Chain 'F':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Chain 'G':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552
• Chain 'H':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Chain 'I':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552 (Start-238)
• Chain 'J':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Chain 'K':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552
• Chain 'L':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Chain 'M':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552 (Start-238)
• Chain 'N':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Chain 'O':
  Compound: enterotoxin type b
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: entB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01552 (Start-238)
• Chain 'P':
  Compound: g5-8
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R8B
• Heterogens: ZN, CL, SO4

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3r8bD (D:)
  marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
  ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
  vdlqp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3r8bD (D:)
  eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
  ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygs
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.