PDB entry 3r7k

View 3r7k on RCSB PDB site
Description: Crystal structure of a probable acyl CoA dehydrogenase from Mycobacterium abscessus ATCC 19977 / DSM 44196
Class: oxidoreductase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2011-03-22, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acyl CoA dehydrogenase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_2085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7ka1, d3r7ka2
  • Chain 'B':
    Compound: Probable acyl CoA dehydrogenase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_2085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7kb1, d3r7kb2
  • Chain 'C':
    Compound: Probable acyl CoA dehydrogenase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_2085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7kc1, d3r7kc2
  • Chain 'D':
    Compound: Probable acyl CoA dehydrogenase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_2085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7kd1, d3r7kd2
  • Heterogens: FDA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r7kA (A:)
    gpgsmtdagtttasedgaarfvvapeawttperralsqmarsfvereiapklaewehvge
    iprdlhlnaaevgllgigfpeevggsggnaidsalvteailaaggstgvcaalfthgial
    phiaangsdalieryvrptlagkmigslgvtepgagsdvanlrtravregdtyvvngakt
    fitsgvradfvttavrtggpgyggvsllvidknspgfevsrrldkmgwrcsdtaelsfvd
    vrvpadnlvgaensgflqimqqfqaerlgiavqayatagraldlakswareretfgrplt
    grqiirhklaemarqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavq
    ifggmgymreseierhyrdcrilgigggtneimneviakrigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7kA (A:)
    peawttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevg
    gsggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkm
    igslgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgygg
    vsllvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgaensgflqimqqfq
    aerlgiavqayatagraldlakswareretfgrpltgrqiirhklaemarqvdvactytr
    avmqrwlagedvvaevsmakntavyacdyvvneavqifggmgymreseierhyrdcrilg
    igggtneimneviakrig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r7kB (B:)
    gpgsmtdagtttasedgaarfvvapeawttperralsqmarsfvereiapklaewehvge
    iprdlhlnaaevgllgigfpeevggsggnaidsalvteailaaggstgvcaalfthgial
    phiaangsdalieryvrptlagkmigslgvtepgagsdvanlrtravregdtyvvngakt
    fitsgvradfvttavrtggpgyggvsllvidknspgfevsrrldkmgwrcsdtaelsfvd
    vrvpadnlvgaensgflqimqqfqaerlgiavqayatagraldlakswareretfgrplt
    grqiirhklaemarqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavq
    ifggmgymreseierhyrdcrilgigggtneimneviakrigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7kB (B:)
    peawttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevg
    gsggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkm
    igslgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgygg
    vsllvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgaensgflqimqqfq
    aerlgiavqayatagraldlakswareretfgrpltgrqiirhklaemarqvdvactytr
    avmqrwlagedvvaevsmakntavyacdyvvneavqifggmgymreseierhyrdcrilg
    igggtneimneviakrig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r7kC (C:)
    gpgsmtdagtttasedgaarfvvapeawttperralsqmarsfvereiapklaewehvge
    iprdlhlnaaevgllgigfpeevggsggnaidsalvteailaaggstgvcaalfthgial
    phiaangsdalieryvrptlagkmigslgvtepgagsdvanlrtravregdtyvvngakt
    fitsgvradfvttavrtggpgyggvsllvidknspgfevsrrldkmgwrcsdtaelsfvd
    vrvpadnlvgaensgflqimqqfqaerlgiavqayatagraldlakswareretfgrplt
    grqiirhklaemarqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavq
    ifggmgymreseierhyrdcrilgigggtneimneviakrigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7kC (C:)
    awttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevggs
    ggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkmig
    slgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgyggvs
    llvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgaensgflqimqqfqae
    rlgiavqayatagraldlakswareretfgrpltgrqiirhklaemarqvdvactytrav
    mqrwlagedvvaevsmakntavyacdyvvneavqifggmgymreseierhyrdcrilgig
    ggtneimneviakrigl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r7kD (D:)
    gpgsmtdagtttasedgaarfvvapeawttperralsqmarsfvereiapklaewehvge
    iprdlhlnaaevgllgigfpeevggsggnaidsalvteailaaggstgvcaalfthgial
    phiaangsdalieryvrptlagkmigslgvtepgagsdvanlrtravregdtyvvngakt
    fitsgvradfvttavrtggpgyggvsllvidknspgfevsrrldkmgwrcsdtaelsfvd
    vrvpadnlvgaensgflqimqqfqaerlgiavqayatagraldlakswareretfgrplt
    grqiirhklaemarqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavq
    ifggmgymreseierhyrdcrilgigggtneimneviakrigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7kD (D:)
    awttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevggs
    ggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkmig
    slgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgyggvs
    llvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgaensgflqimqqfqae
    rlgiavqayatagraldlakswareretfgrpltgrqiirhklaemarqvdvactytrav
    mqrwlagedvvaevsmakntavyacdyvvneavqifggmgymreseierhyrdcrilgig
    ggtneimneviakrig