PDB entry 3r6s

View 3r6s on RCSB PDB site
Description: Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
Class: transcription
Keywords: N-terminal cAMP-binding domain, C-terminal HTH-motif, Transcription factor, Homodimer, TRANSCRIPTION
Deposited on 2011-03-22, released 2012-03-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription regulator
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0350, cg0350 (glxR), Cgl0291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r6sa1, d3r6sa2
  • Chain 'B':
    Compound: Transcription regulator
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0350, cg0350 (glxR), Cgl0291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r6sb1, d3r6sb2
  • Chain 'C':
    Compound: Transcription regulator
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0350, cg0350 (glxR), Cgl0291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r6sc1, d3r6sc2
  • Chain 'D':
    Compound: Transcription regulator
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0350, cg0350 (glxR), Cgl0291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r6sd1, d3r6sd2
  • Chain 'E':
    Compound: Transcription regulator
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0350, cg0350 (glxR), Cgl0291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r6se1, d3r6se2
  • Chain 'F':
    Compound: Transcription regulator
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0350, cg0350 (glxR), Cgl0291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r6sf1, d3r6sf2
  • Heterogens: CMP, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r6sA (A:)
    mgsshhhhhhssglvprgshmegvqeilsragifqgvdptavnnliqdmetvrfprgati
    fdegepgdrlyiitsgkvklarhapdgrenlltimgpsdmfgelsifdpgprtssavcvt
    evhaatmnsdmlrnwvadhpaiaeqllrvlarrlrrtnasladliftdvpgrvaktllql
    anrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwirlegksvlivdte
    hlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r6sA (A:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
    aeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltqee
    iaqlvgasretvnkalatfahrgwirlegksvlivdtehlarrar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r6sB (B:)
    mgsshhhhhhssglvprgshmegvqeilsragifqgvdptavnnliqdmetvrfprgati
    fdegepgdrlyiitsgkvklarhapdgrenlltimgpsdmfgelsifdpgprtssavcvt
    evhaatmnsdmlrnwvadhpaiaeqllrvlarrlrrtnasladliftdvpgrvaktllql
    anrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwirlegksvlivdte
    hlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r6sB (B:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
    aeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltqee
    iaqlvgasretvnkalatfahrgwirlegksvlivdtehlarrar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r6sC (C:)
    mgsshhhhhhssglvprgshmegvqeilsragifqgvdptavnnliqdmetvrfprgati
    fdegepgdrlyiitsgkvklarhapdgrenlltimgpsdmfgelsifdpgprtssavcvt
    evhaatmnsdmlrnwvadhpaiaeqllrvlarrlrrtnasladliftdvpgrvaktllql
    anrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwirlegksvlivdte
    hlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r6sC (C:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
    aeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltqee
    iaqlvgasretvnkalatfahrgwirlegksvlivdtehlarra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r6sD (D:)
    mgsshhhhhhssglvprgshmegvqeilsragifqgvdptavnnliqdmetvrfprgati
    fdegepgdrlyiitsgkvklarhapdgrenlltimgpsdmfgelsifdpgprtssavcvt
    evhaatmnsdmlrnwvadhpaiaeqllrvlarrlrrtnasladliftdvpgrvaktllql
    anrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwirlegksvlivdte
    hlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r6sD (D:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
    aeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltqee
    iaqlvgasretvnkalatfahrgwirlegksvlivdtehlarra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3r6sE (E:)
    mgsshhhhhhssglvprgshmegvqeilsragifqgvdptavnnliqdmetvrfprgati
    fdegepgdrlyiitsgkvklarhapdgrenlltimgpsdmfgelsifdpgprtssavcvt
    evhaatmnsdmlrnwvadhpaiaeqllrvlarrlrrtnasladliftdvpgrvaktllql
    anrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwirlegksvlivdte
    hlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r6sE (E:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
    aeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltqee
    iaqlvgasretvnkalatfahrgwirlegksvlivdtehlarrar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3r6sF (F:)
    mgsshhhhhhssglvprgshmegvqeilsragifqgvdptavnnliqdmetvrfprgati
    fdegepgdrlyiitsgkvklarhapdgrenlltimgpsdmfgelsifdpgprtssavcvt
    evhaatmnsdmlrnwvadhpaiaeqllrvlarrlrrtnasladliftdvpgrvaktllql
    anrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwirlegksvlivdte
    hlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r6sF (F:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    harenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpaiaeq
    llrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaq
    lvgasretvnkalatfahrgwirlegksvlivdtehlarrar